PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_010922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 297aa    MW: 32836 Da    PI: 6.8347
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_010922genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.91.8e-4371061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+  +reda++sl+yeA+ar+rdPvyG+vg+i+ lq++l+q++++l  +k
  DCAR_010922   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNDLNAAQREDAVNSLAYEADARLRDPVYGCVGLISILQHKLKQVQVDLFNAK 104
                  7********************************************************************************************98888 PP

       DUF260  99 ee 100
                  +e
  DCAR_010922 105 KE 106
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8146107IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNDLNAAQR  60
EDAVNSLAYE ADARLRDPVY GCVGLISILQ HKLKQVQVDL FNAKKELASY IGPSAMLPIL  120
QHPGLIQQHP SNPQNVLGYN NMQPMLGLSM NQPHGAMPLM IRDPQQQQML EAQHLAAAER  180
EQAEIMRTYN EQQQPPPDQH PRFNNGFDTS GQTAASGFNQ TIADGSTMSL VLGSYENQYG  240
HHPIQQQPQE PHIHHNQVLQ IQPQLLLQQQ QQIAPPQAVT QHRDGSEEGR SGGPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774046.11e-104PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016502483.11e-104PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-78LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-106A0A0B0PS92_G
STRINGSolyc02g065150.1.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-80ASYMMETRIC LEAVES 2-like 1